Lineage for d1j34a_ (1j34 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2607280Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2607593Protein Snake coagglutinin alpha chain [88861] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 2607594Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [88862] (6 PDB entries)
  8. 2607595Domain d1j34a_: 1j34 A: [84048]
    Other proteins in same PDB: d1j34b_, d1j34c_
    complexed with ca, mg

Details for d1j34a_

PDB Entry: 1j34 (more details), 1.55 Å

PDB Description: Crystal Structure of Mg(II)-and Ca(II)-bound Gla Domain of Factor IX Complexed with Binding Protein
PDB Compounds: (A:) coagulation factor IX-binding protein A chain

SCOPe Domain Sequences for d1j34a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j34a_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]}
dcpsgwssyeghcykpfklyktwddaerfcteqakgghlvsiesageadfvaqlvteniq
ntksyvwiglrvqgkekqcssewsdgssvsyenwieaesktclgleketgfrkwvniycg
qqnpfvcea

SCOPe Domain Coordinates for d1j34a_:

Click to download the PDB-style file with coordinates for d1j34a_.
(The format of our PDB-style files is described here.)

Timeline for d1j34a_: