Lineage for d1j34a_ (1j34 A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 336759Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 336760Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 336761Family d.169.1.1: C-type lectin domain [56437] (21 proteins)
  6. 336965Protein Snake coagglutinin alpha chain [88861] (5 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 336966Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [88862] (4 PDB entries)
  8. 336967Domain d1j34a_: 1j34 A: [84048]
    Other proteins in same PDB: d1j34b_, d1j34c_
    complexed with ca, cgu, mg

Details for d1j34a_

PDB Entry: 1j34 (more details), 1.55 Å

PDB Description: Crystal Structure of Mg(II)-and Ca(II)-bound Gla Domain of Factor IX Complexed with Binding Protein

SCOP Domain Sequences for d1j34a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j34a_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis)}
dcpsgwssyeghcykpfklyktwddaerfcteqakgghlvsiesageadfvaqlvteniq
ntksyvwiglrvqgkekqcssewsdgssvsyenwieaesktclgleketgfrkwvniycg
qqnpfvcea

SCOP Domain Coordinates for d1j34a_:

Click to download the PDB-style file with coordinates for d1j34a_.
(The format of our PDB-style files is described here.)

Timeline for d1j34a_: