Lineage for d1j2qj_ (1j2q J:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2990986Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2990987Species Archaeoglobus fulgidus [TaxId:2234] [90043] (1 PDB entry)
  8. 2990990Domain d1j2qj_: 1j2q J: [84038]
    Other proteins in same PDB: d1j2qa_, d1j2qb_, d1j2qc_, d1j2qd_, d1j2qe_, d1j2qf_, d1j2qg_
    complexed with cib

Details for d1j2qj_

PDB Entry: 1j2q (more details), 2.83 Å

PDB Description: 20S proteasome in complex with calpain-Inhibitor I from archaeoglobus fulgidus
PDB Compounds: (J:) Proteasome beta subunit

SCOPe Domain Sequences for d1j2qj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j2qj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Archaeoglobus fulgidus [TaxId: 2234]}
tttvglvckdgvvmatekratmgnfiaskaakkiyqiadrmamttagsvgdaqflariik
ieanlyeirrerkptvraiatltsnllnsyryfpylvqlliggidsegksiysidpigga
ieekdivatgsgsltaygvledrftpeigvdeavelavraiysamkrdsasgdgidvvki
tedefyqyspeeveqilakfrk

SCOPe Domain Coordinates for d1j2qj_:

Click to download the PDB-style file with coordinates for d1j2qj_.
(The format of our PDB-style files is described here.)

Timeline for d1j2qj_: