Lineage for d1j2qh_ (1j2q H:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044569Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1044570Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1044729Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1045208Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1045209Species Archaeoglobus fulgidus [TaxId:2234] [90043] (1 PDB entry)
  8. 1045210Domain d1j2qh_: 1j2q H: [84036]
    Other proteins in same PDB: d1j2qa_, d1j2qb_, d1j2qc_, d1j2qd_, d1j2qe_, d1j2qf_, d1j2qg_
    complexed with cib

Details for d1j2qh_

PDB Entry: 1j2q (more details), 2.83 Å

PDB Description: 20S proteasome in complex with calpain-Inhibitor I from archaeoglobus fulgidus
PDB Compounds: (H:) Proteasome beta subunit

SCOPe Domain Sequences for d1j2qh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeoglobus fulgidus [TaxId: 2234]}
tttvglvckdgvvmatekratmgnfiaskaakkiyqiadrmamttagsvgdaqflariik
ieanlyeirrerkptvraiatltsnllnsyryfpylvqlliggidsegksiysidpigga
ieekdivatgsgsltaygvledrftpeigvdeavelavraiysamkrdsasgdgidvvki
tedefyqyspeeveqilakfrk

SCOPe Domain Coordinates for d1j2qh_:

Click to download the PDB-style file with coordinates for d1j2qh_.
(The format of our PDB-style files is described here.)

Timeline for d1j2qh_: