Lineage for d1j2qh_ (1j2q H:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875596Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 875597Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (7 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 875747Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 876137Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 876138Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [90043] (1 PDB entry)
  8. 876139Domain d1j2qh_: 1j2q H: [84036]
    Other proteins in same PDB: d1j2qa_, d1j2qb_, d1j2qc_, d1j2qd_, d1j2qe_, d1j2qf_, d1j2qg_

Details for d1j2qh_

PDB Entry: 1j2q (more details), 2.83 Å

PDB Description: 20S proteasome in complex with calpain-Inhibitor I from archaeoglobus fulgidus
PDB Compounds: (H:) Proteasome beta subunit

SCOP Domain Sequences for d1j2qh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
tttvglvckdgvvmatekratmgnfiaskaakkiyqiadrmamttagsvgdaqflariik
ieanlyeirrerkptvraiatltsnllnsyryfpylvqlliggidsegksiysidpigga
ieekdivatgsgsltaygvledrftpeigvdeavelavraiysamkrdsasgdgidvvki
tedefyqyspeeveqilakfrk

SCOP Domain Coordinates for d1j2qh_:

Click to download the PDB-style file with coordinates for d1j2qh_.
(The format of our PDB-style files is described here.)

Timeline for d1j2qh_: