Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (7 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (3 proteins) |
Protein Proteasome beta subunit (catalytic) [56252] (5 species) |
Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [90043] (1 PDB entry) |
Domain d1j2qh_: 1j2q H: [84036] Other proteins in same PDB: d1j2qa_, d1j2qb_, d1j2qc_, d1j2qd_, d1j2qe_, d1j2qf_, d1j2qg_ |
PDB Entry: 1j2q (more details), 2.83 Å
SCOP Domain Sequences for d1j2qh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} tttvglvckdgvvmatekratmgnfiaskaakkiyqiadrmamttagsvgdaqflariik ieanlyeirrerkptvraiatltsnllnsyryfpylvqlliggidsegksiysidpigga ieekdivatgsgsltaygvledrftpeigvdeavelavraiysamkrdsasgdgidvvki tedefyqyspeeveqilakfrk
Timeline for d1j2qh_: