Lineage for d1j2qf_ (1j2q F:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1437785Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1437897Protein Proteasome alpha subunit (non-catalytic) [56255] (6 species)
    contains an extension to the common fold at the N-terminus
  7. 1437898Species Archaeoglobus fulgidus [TaxId:2234] [90044] (2 PDB entries)
  8. 1437911Domain d1j2qf_: 1j2q F: [84034]
    Other proteins in same PDB: d1j2qh_, d1j2qi_, d1j2qj_, d1j2qk_, d1j2ql_, d1j2qm_, d1j2qn_
    complexed with cib

Details for d1j2qf_

PDB Entry: 1j2q (more details), 2.83 Å

PDB Description: 20S proteasome in complex with calpain-Inhibitor I from archaeoglobus fulgidus
PDB Compounds: (F:) Proteasome alpha subunit

SCOPe Domain Sequences for d1j2qf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j2qf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Archaeoglobus fulgidus [TaxId: 2234]}
raitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadtiekiyk
idehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqytqyggv
rpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddlsfddam
vlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirellkk

SCOPe Domain Coordinates for d1j2qf_:

Click to download the PDB-style file with coordinates for d1j2qf_.
(The format of our PDB-style files is described here.)

Timeline for d1j2qf_: