Lineage for d1j2qd_ (1j2q D:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875596Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 875597Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (7 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 875747Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 875859Protein Proteasome alpha subunit (non-catalytic) [56255] (5 species)
    contains an extension to the common fold at the N-terminus
  7. 875860Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [90044] (2 PDB entries)
  8. 875871Domain d1j2qd_: 1j2q D: [84032]
    Other proteins in same PDB: d1j2qh_, d1j2qi_, d1j2qj_, d1j2qk_, d1j2ql_, d1j2qm_, d1j2qn_

Details for d1j2qd_

PDB Entry: 1j2q (more details), 2.83 Å

PDB Description: 20S proteasome in complex with calpain-Inhibitor I from archaeoglobus fulgidus
PDB Compounds: (D:) Proteasome alpha subunit

SCOP Domain Sequences for d1j2qd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j2qd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
raitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadtiekiyk
idehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqytqyggv
rpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddlsfddam
vlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirellkk

SCOP Domain Coordinates for d1j2qd_:

Click to download the PDB-style file with coordinates for d1j2qd_.
(The format of our PDB-style files is described here.)

Timeline for d1j2qd_: