Lineage for d1j2qc_ (1j2q C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2549037Protein Proteasome alpha subunit (non-catalytic) [56255] (9 species)
    contains an extension to the common fold at the N-terminus
  7. 2549038Species Archaeoglobus fulgidus [TaxId:2234] [90044] (2 PDB entries)
  8. 2549048Domain d1j2qc_: 1j2q C: [84031]
    Other proteins in same PDB: d1j2qh_, d1j2qi_, d1j2qj_, d1j2qk_, d1j2ql_, d1j2qm_, d1j2qn_
    complexed with cib

Details for d1j2qc_

PDB Entry: 1j2q (more details), 2.83 Å

PDB Description: 20S proteasome in complex with calpain-Inhibitor I from archaeoglobus fulgidus
PDB Compounds: (C:) Proteasome alpha subunit

SCOPe Domain Sequences for d1j2qc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j2qc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Archaeoglobus fulgidus [TaxId: 2234]}
raitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadtiekiyk
idehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqytqyggv
rpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddlsfddam
vlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirellkk

SCOPe Domain Coordinates for d1j2qc_:

Click to download the PDB-style file with coordinates for d1j2qc_.
(The format of our PDB-style files is described here.)

Timeline for d1j2qc_: