Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (3 proteins) |
Protein Proteasome alpha subunit (non-catalytic) [56255] (5 species) contains an extension to the common fold at the N-terminus |
Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [90044] (2 PDB entries) |
Domain d1j2pg_: 1j2p G: [84028] alpha-ring only |
PDB Entry: 1j2p (more details), 2.6 Å
SCOP Domain Sequences for d1j2pg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j2pg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus} pqmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgskllekdt iekiykidehicaatsglvadarvlidrarieaqinrltydipitvkelakkicdfkqqy tqyggvrpfgvslliagvnevpklyetdpsgalleykataigmgrmavteffekeyrddl sfddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirel lkk
Timeline for d1j2pg_: