Lineage for d1j2pd_ (1j2p D:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 335536Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 335537Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 335658Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 335743Protein Proteasome alpha subunit (non-catalytic) [56255] (4 species)
    contains an extension to the common fold at the N-teminus
  7. 335744Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [90044] (2 PDB entries)
  8. 335748Domain d1j2pd_: 1j2p D: [84025]

Details for d1j2pd_

PDB Entry: 1j2p (more details), 2.6 Å

PDB Description: alpha-ring from the proteasome from archaeoglobus fulgidus

SCOP Domain Sequences for d1j2pd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j2pd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus}
pqmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgskllekdt
iekiykidehicaatsglvadarvlidrarieaqinrltydipitvkelakkicdfkqqy
tqyggvrpfgvslliagvnevpklyetdpsgalleykataigmgrmavteffekeyrddl
sfddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirel
lkk

SCOP Domain Coordinates for d1j2pd_:

Click to download the PDB-style file with coordinates for d1j2pd_.
(The format of our PDB-style files is described here.)

Timeline for d1j2pd_: