SCOP 1.73: Domain d1j2pb_: 1j2p B:

Lineage for d1j2pb_ (1j2p B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (6 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (3 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (5 species)
   contains an extension to the common fold at the N-terminus

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [90044] (2 PDB entries)

8. Domain d1j2pb_: 1j2p B: [84023]

Details for d1j2pb_

PDB Entry: 1j2p, 2.6 Å

PDB Description: alpha-ring from the proteasome from archaeoglobus fulgidus

PDB Compounds: (B:) Proteasome alpha subunit

SCOP Domain Sequences for d1j2pb_:

Sequence; same for both SEQRES and ATOM records:

>d1j2pb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
pqmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgskllekdt
iekiykidehicaatsglvadarvlidrarieaqinrltydipitvkelakkicdfkqqy
tqyggvrpfgvslliagvnevpklyetdpsgalleykataigmgrmavteffekeyrddl
sfddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirel
lkk

Timeline for d1j2pb_:

• d1j2pb_ first appeared in SCOP 1.65
  
• d1j2pb_ appears in SCOP 1.71
  
• d1j2pb_ appears in SCOP 1.75
  
• d1j2pb_ appears in the current release, SCOPe 2.08