SCOP 1.71: Domain d1j2jb_: 1j2j B:

Lineage for d1j2jb_ (1j2j B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.7: Spectrin repeat-like [46965] (13 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.8: GAT-like domain [89009] (2 families)

5. Family a.7.8.1: GAT domain [89010] (1 protein)
   this is a repeat family; one repeat unit is 1yd8 G:208-299 found in domain

6. Protein ADP-ribosylation factor binding protein Gga1 [89011] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89012] (6 PDB entries)

8. Domain d1j2jb_: 1j2j B: [84017]
   Other proteins in same PDB: d1j2ja_
   structure of a two-helical fragment bound to ARF1
   complexed with gtp, iod, mg; mutant

Details for d1j2jb_

PDB Entry: 1j2j, 1.6 Å

PDB Description: crystal structure of gga1 gat n-terminal region in complex with arf1 gtp form

SCOP Domain Sequences for d1j2jb_:

Sequence; same for both SEQRES and ATOM records:

>d1j2jb_ a.7.8.1 (B:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens)}
ifedeekskmlarllksshpedlraanklikemvqedqkrm

Timeline for d1j2jb_:

• d1j2jb_ first appeared in SCOP 1.65
  
• d1j2jb_ appears in SCOP 1.69
  
• d1j2jb_ appears in SCOP 1.73
  
• d1j2jb_ appears in the current release, SCOPe 2.08