Lineage for d1j2jb_ (1j2j B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534473Fold a.7: Spectrin repeat-like [46965] (13 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 534615Superfamily a.7.8: GAT-like domain [89009] (2 families) (S)
  5. 534616Family a.7.8.1: GAT domain [89010] (1 protein)
    this is a repeat family; one repeat unit is 1yd8 G:208-299 found in domain
  6. 534617Protein ADP-ribosylation factor binding protein Gga1 [89011] (1 species)
  7. 534618Species Human (Homo sapiens) [TaxId:9606] [89012] (6 PDB entries)
  8. 534619Domain d1j2jb_: 1j2j B: [84017]
    Other proteins in same PDB: d1j2ja_
    structure of a two-helical fragment bound to ARF1
    complexed with gtp, iod, mg; mutant

Details for d1j2jb_

PDB Entry: 1j2j (more details), 1.6 Å

PDB Description: crystal structure of gga1 gat n-terminal region in complex with arf1 gtp form

SCOP Domain Sequences for d1j2jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j2jb_ a.7.8.1 (B:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens)}
ifedeekskmlarllksshpedlraanklikemvqedqkrm

SCOP Domain Coordinates for d1j2jb_:

Click to download the PDB-style file with coordinates for d1j2jb_.
(The format of our PDB-style files is described here.)

Timeline for d1j2jb_: