Lineage for d1j1va_ (1j1v A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2309098Superfamily a.4.12: TrpR-like [48295] (4 families) (S)
    contains an extra shared helix after the HTH motif
  5. 2309180Family a.4.12.2: Chromosomal replication initiation factor DnaA C-terminal domain IV [81695] (1 protein)
    monomeric; contains additional N-terminal helices
  6. 2309181Protein Chromosomal replication initiation factor DnaA C-terminal domain IV [81696] (2 species)
  7. 2309188Species Escherichia coli [TaxId:562] [88992] (1 PDB entry)
  8. 2309189Domain d1j1va_: 1j1v A: [83981]
    domain IV only; complexed with DnaA box DNA
    protein/DNA complex

Details for d1j1va_

PDB Entry: 1j1v (more details), 2.1 Å

PDB Description: Crystal structure of DnaA domainIV complexed with DnaAbox DNA
PDB Compounds: (A:) Chromosomal replication initiator protein dnaA

SCOPe Domain Sequences for d1j1va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j1va_ a.4.12.2 (A:) Chromosomal replication initiation factor DnaA C-terminal domain IV {Escherichia coli [TaxId: 562]}
vtidniqktvaeyykikvadllskrrsrsvarprqmamalakeltnhslpeigdafggrd
httvlhacrkieqlreeshdikedfsnlirtlss

SCOPe Domain Coordinates for d1j1va_:

Click to download the PDB-style file with coordinates for d1j1va_.
(The format of our PDB-style files is described here.)

Timeline for d1j1va_: