Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.12: TrpR-like [48295] (4 families) contains an extra shared helix after the HTH motif |
Family a.4.12.2: Chromosomal replication initiation factor DnaA C-terminal domain IV [81695] (1 protein) monomeric; contains additional N-terminal helices |
Protein Chromosomal replication initiation factor DnaA C-terminal domain IV [81696] (2 species) |
Species Escherichia coli [TaxId:562] [88992] (1 PDB entry) |
Domain d1j1va_: 1j1v A: [83981] domain IV only; complexed with DnaA box DNA protein/DNA complex |
PDB Entry: 1j1v (more details), 2.1 Å
SCOPe Domain Sequences for d1j1va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j1va_ a.4.12.2 (A:) Chromosomal replication initiation factor DnaA C-terminal domain IV {Escherichia coli [TaxId: 562]} vtidniqktvaeyykikvadllskrrsrsvarprqmamalakeltnhslpeigdafggrd httvlhacrkieqlreeshdikedfsnlirtlss
Timeline for d1j1va_: