Lineage for d1j0ma3 (1j0m A:387-659)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1534928Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1535067Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 1535274Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (4 proteins)
    automatically mapped to Pfam PF02278
  6. Protein Xanthan lyase [89282] (1 species)
  7. Species Bacillus sp. GL1 [TaxId:84635] [89283] (2 PDB entries)
  8. 1535319Domain d1j0ma3: 1j0m A:387-659 [83912]
    Other proteins in same PDB: d1j0ma1, d1j0ma2
    complexed with ca

Details for d1j0ma3

PDB Entry: 1j0m (more details), 2.3 Å

PDB Description: crystal structure of bacillus sp. gl1 xanthan lyase that acts on side chains of xanthan
PDB Compounds: (A:) xanthan lyase

SCOPe Domain Sequences for d1j0ma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0ma3 b.30.5.2 (A:387-659) Xanthan lyase {Bacillus sp. GL1 [TaxId: 84635]}
pnlykqyaamdravlqrpgfalglalystrissyesinsengrgwytgagatylynqdla
qysedywptvdayripgttvasgtpiasgtgtsswtggvslagqygasgmdlsygaynls
arkswfmfddeivalgsgisstagipietvvdnrklngagdnawtangaalstglgvaqt
ltgvnwvhlagntadgsdigyyfpggatlqtkreartgtwkqinnrpatpstavtrnyet
mwidhgtnpsgasygyvllpnktsaqvgayaad

SCOPe Domain Coordinates for d1j0ma3:

Click to download the PDB-style file with coordinates for d1j0ma3.
(The format of our PDB-style files is described here.)

Timeline for d1j0ma3: