Lineage for d1j0dc_ (1j0d C:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 844422Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 844423Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 844424Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins)
  6. 844425Protein 1-aminocyclopropane-1-carboxylate deaminase [53694] (3 species)
  7. 844479Species Yeast (Hansenula saturnus) [TaxId:4906] [53695] (4 PDB entries)
  8. 844486Domain d1j0dc_: 1j0d C: [83904]

Details for d1j0dc_

PDB Entry: 1j0d (more details), 2.2 Å

PDB Description: acc deaminase mutant complexed with acc
PDB Compounds: (C:) 1-aminocyclopropane-1-carboxylate deaminase

SCOP Domain Sequences for d1j0dc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0dc_ c.79.1.1 (C:) 1-aminocyclopropane-1-carboxylate deaminase {Yeast (Hansenula saturnus) [TaxId: 4906]}
agvakfakypltfgpspisnlnrlsqhlgskvnvyakredcnsglafggntlrkleyivp
divegdythlvsiggrqsnqtrmvaalaaklgkkcvliqedwvpipeaekdvynrvgnie
lsrimgadvrviedgfdigmrksfanalqeledaghkpypipagcsehkygglgfvgfad
evinqevelgikfdkivvccvtgsttagilagmaqygrqddviaidasftsektkeqtlr
ianntakligvehefkdftldtrfaypcygvpnegtieairtcaeqegvltdpvyegksm
qglialikedyfkpganvlyvhlggapalsayssffptkta

SCOP Domain Coordinates for d1j0dc_:

Click to download the PDB-style file with coordinates for d1j0dc_.
(The format of our PDB-style files is described here.)

Timeline for d1j0dc_: