Lineage for d1j0cb_ (1j0c B:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 320763Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 320764Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 320765Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (6 proteins)
  6. 320766Protein 1-aminocyclopropane-1-carboxylate deaminase [53694] (2 species)
  7. 320795Species Yeast (Hansenula saturnus) [TaxId:4906] [53695] (4 PDB entries)
  8. 320809Domain d1j0cb_: 1j0c B: [83899]

Details for d1j0cb_

PDB Entry: 1j0c (more details), 2.75 Å

PDB Description: ACC deaminase mutated to catalytic residue

SCOP Domain Sequences for d1j0cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0cb_ c.79.1.1 (B:) 1-aminocyclopropane-1-carboxylate deaminase {Yeast (Hansenula saturnus)}
agvakfakypltfgpspisnlnrlsqhlgskvnvyakredcnsglafggntlrkleyivp
divegdythlvsiggrqsnqtrmvaalaaklgkkcvliqedwvpipeaekdvynrvgnie
lsrimgadvrviedgfdigmrksfanalqeledaghkpypipagcsehkygglgfvgfad
evinqevelgikfdkivvccvtgsttagilagmaqygrqddviaidasftsektkeqtlr
ianntakligvehefkdftldtrfaypcygvpnegtieairtcaeqegvltdpvyegksm
qglialikedyfkpganvlyvhlggapalsayssffptkta

SCOP Domain Coordinates for d1j0cb_:

Click to download the PDB-style file with coordinates for d1j0cb_.
(The format of our PDB-style files is described here.)

Timeline for d1j0cb_: