SCOPe 2.05: Domain d1iz3a_: 1iz3 A:

Lineage for d1iz3a_ (1iz3 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.6: Hypoxia-inducible factor HIF ihhibitor (FIH1) [82194] (1 protein)

6. Protein Hypoxia-inducible factor HIF ihhibitor (FIH1) [82195] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82196] (28 PDB entries)

8. Domain d1iz3a_: 1iz3 A: [83831]
   complexed with so4

Details for d1iz3a_

PDB Entry: 1iz3, 2.8 Å

PDB Description: Dimeric structure of FIH (Factor inhibiting HIF)

PDB Compounds: (A:) fih

SCOPe Domain Sequences for d1iz3a_:

Sequence; same for both SEQRES and ATOM records:

>d1iz3a_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]}
gsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvy
palkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefvek
lqdiqqrggeerlylqqtlndtvggkivmdflgfnwnwinkqqgkrgwgqltsnllligm
egnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyer
fpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieyplk
ahqkvaimrniekmlgealgnpqevgpllntmikgryn

Timeline for d1iz3a_:

• d1iz3a_ first appeared in SCOP 1.65
  
• d1iz3a_ appears in SCOPe 2.04
  
• d1iz3a_ appears in SCOPe 2.06
  
• d1iz3a_ appears in the current release, SCOPe 2.08