Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
Protein LysR-type regulatory protein CbnR [89789] (1 species) |
Species Ralstonia eutropha [TaxId:106590] [89790] (2 PDB entries) |
Domain d1iz1q2: 1iz1 Q:90-292 [83830] Other proteins in same PDB: d1iz1a1, d1iz1b1, d1iz1p1, d1iz1q1 |
PDB Entry: 1iz1 (more details), 2.5 Å
SCOPe Domain Sequences for d1iz1q2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iz1q2 c.94.1.1 (Q:90-292) LysR-type regulatory protein CbnR {Ralstonia eutropha [TaxId: 106590]} vgelsvayfgtpiyrslplllrafltstptatvslthmtkdeqvegllagtihvgfsrff prhpgieivniaqedlylavhrsqsgkfgktckladlraveltlfprggrpsfadevigl fkhagiepriarvvedataalaltmagaassivpasvaairwpdiafarivgtrvkvpis cifrkekqppilarfvehvrrsa
Timeline for d1iz1q2: