SCOP 1.69: Domain d1iyxb2: 1iyx B:1-136

Lineage for d1iyxb2 (1iyx B:1-136)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (10 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Enolase [54828] (6 species)

7. Species Enterococcus hirae [TaxId:1354] [89926] (1 PDB entry)

8. Domain d1iyxb2: 1iyx B:1-136 [83818]
   Other proteins in same PDB: d1iyxa1, d1iyxb1

Details for d1iyxb2

PDB Entry: 1iyx, 2.8 Å

PDB Description: Crystal structure of enolase from Enterococcus hirae

SCOP Domain Sequences for d1iyxb2:

Sequence; same for both SEQRES and ATOM records:

>d1iyxb2 d.54.1.1 (B:1-136) Enolase {Enterococcus hirae}
siitdvyareildsrgnptievevytesgafgrgmvpsgastgeyeavelrdgdkarygg
kgvtkavdnvnniiaeaiigydvrdqmaidkamialdgtpnkgklganailgvsiavara
aadylevplyhylggf

Timeline for d1iyxb2:

• d1iyxb2 first appeared in SCOP 1.65
  
• d1iyxb2 appears in SCOP 1.67
  
• d1iyxb2 appears in SCOP 1.71
  
• d1iyxb2 appears in the current release, SCOPe 2.08