Lineage for d1iyxb1 (1iyx B:137-431)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 684589Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 684590Family c.1.11.1: Enolase [51605] (1 protein)
  6. 684591Protein Enolase [51606] (7 species)
    Fold of this protein slightly differs from common fold in topology
  7. 684620Species Enterococcus hirae [TaxId:1354] [89498] (1 PDB entry)
  8. 684622Domain d1iyxb1: 1iyx B:137-431 [83817]
    Other proteins in same PDB: d1iyxa2, d1iyxb2
    complexed with cry, mg, so4

Details for d1iyxb1

PDB Entry: 1iyx (more details), 2.8 Å

PDB Description: Crystal structure of enolase from Enterococcus hirae
PDB Compounds: (B:) enolase

SCOP Domain Sequences for d1iyxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyxb1 c.1.11.1 (B:137-431) Enolase {Enterococcus hirae [TaxId: 1354]}
ntkvlptpmmniinggshadnsidfqefmimpvgaptfkealrmgaevfhalaailksrg
latsvgdeggfapnlgsneegfeviieaiekagyvpgkdvvlamdaassefydkekgvyv
ladsgegekttdemikfyeelvskypiisiedgldendwdgfkkltdvlgdkvqlvgddl
fvtntqklsegiekgiansilikvnqigtltetfeaiemakeagytavvshrsgetedst
isdiavatnagqiktgslsrtdriakynqllriedqlgevaeykglksfynlkaa

SCOP Domain Coordinates for d1iyxb1:

Click to download the PDB-style file with coordinates for d1iyxb1.
(The format of our PDB-style files is described here.)

Timeline for d1iyxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iyxb2