SCOPe 2.08: Domain d1iyxa1: 1iyx A:137-431

Lineage for d1iyxa1 (1iyx A:137-431)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.1: Enolase [51605] (2 proteins)
   automatically mapped to Pfam PF00113

6. Protein Enolase [51606] (11 species)
   Fold of this protein slightly differs from common fold in topology

7. Species Enterococcus hirae [TaxId:1354] [89498] (1 PDB entry)

8. Domain d1iyxa1: 1iyx A:137-431 [83815]
   Other proteins in same PDB: d1iyxa2, d1iyxb2
   complexed with gol, mg, so4

Details for d1iyxa1

PDB Entry: 1iyx, 2.8 Å

PDB Description: Crystal structure of enolase from Enterococcus hirae

PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d1iyxa1:

Sequence; same for both SEQRES and ATOM records:

>d1iyxa1 c.1.11.1 (A:137-431) Enolase {Enterococcus hirae [TaxId: 1354]}
ntkvlptpmmniinggshadnsidfqefmimpvgaptfkealrmgaevfhalaailksrg
latsvgdeggfapnlgsneegfeviieaiekagyvpgkdvvlamdaassefydkekgvyv
ladsgegekttdemikfyeelvskypiisiedgldendwdgfkkltdvlgdkvqlvgddl
fvtntqklsegiekgiansilikvnqigtltetfeaiemakeagytavvshrsgetedst
isdiavatnagqiktgslsrtdriakynqllriedqlgevaeykglksfynlkaa

Timeline for d1iyxa1:

• d1iyxa1 first appeared in SCOP 1.65
  
• d1iyxa1 appears in SCOPe 2.07