Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.1: Enolase [51605] (2 proteins) automatically mapped to Pfam PF00113 |
Protein Enolase [51606] (11 species) Fold of this protein slightly differs from common fold in topology |
Species Enterococcus hirae [TaxId:1354] [89498] (1 PDB entry) |
Domain d1iyxa1: 1iyx A:137-431 [83815] Other proteins in same PDB: d1iyxa2, d1iyxb2 complexed with gol, mg, so4 |
PDB Entry: 1iyx (more details), 2.8 Å
SCOPe Domain Sequences for d1iyxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iyxa1 c.1.11.1 (A:137-431) Enolase {Enterococcus hirae [TaxId: 1354]} ntkvlptpmmniinggshadnsidfqefmimpvgaptfkealrmgaevfhalaailksrg latsvgdeggfapnlgsneegfeviieaiekagyvpgkdvvlamdaassefydkekgvyv ladsgegekttdemikfyeelvskypiisiedgldendwdgfkkltdvlgdkvqlvgddl fvtntqklsegiekgiansilikvnqigtltetfeaiemakeagytavvshrsgetedst isdiavatnagqiktgslsrtdriakynqllriedqlgevaeykglksfynlkaa
Timeline for d1iyxa1: