Lineage for d1iyid2 (1iyi D:602-675)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2132062Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2132557Protein Class sigma GST [81362] (5 species)
  7. 2132570Species Human (Homo sapiens) [TaxId:9606] [89705] (7 PDB entries)
    Uniprot O60760
    synonym: hematopoietic prostaglandin D synthase
  8. 2132594Domain d1iyid2: 1iyi D:602-675 [83805]
    Other proteins in same PDB: d1iyia1, d1iyib1, d1iyic1, d1iyid1
    complexed with ca, gsh

Details for d1iyid2

PDB Entry: 1iyi (more details), 1.8 Å

PDB Description: Crystal structure of hematopoietic prostaglandin D synthase
PDB Compounds: (D:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d1iyid2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyid2 c.47.1.5 (D:602-675) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt

SCOPe Domain Coordinates for d1iyid2:

Click to download the PDB-style file with coordinates for d1iyid2.
(The format of our PDB-style files is described here.)

Timeline for d1iyid2: