Lineage for d1iyic2 (1iyi C:402-475)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 315307Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 315308Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 315468Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)
  6. 315767Protein Class sigma GST [81362] (4 species)
  7. 315771Species Human (Homo sapiens) [TaxId:9606] [89705] (2 PDB entries)
    synonym: hematopoietic prostaglandin D synthase
  8. 315778Domain d1iyic2: 1iyi C:402-475 [83803]
    Other proteins in same PDB: d1iyia1, d1iyib1, d1iyic1, d1iyid1

Details for d1iyic2

PDB Entry: 1iyi (more details), 1.8 Å

PDB Description: Crystal structure of hematopoietic prostaglandin D synthase

SCOP Domain Sequences for d1iyic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyic2 c.47.1.5 (C:402-475) Class sigma GST {Human (Homo sapiens)}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt

SCOP Domain Coordinates for d1iyic2:

Click to download the PDB-style file with coordinates for d1iyic2.
(The format of our PDB-style files is described here.)

Timeline for d1iyic2: