SCOP 1.65: Domain d1iyib2: 1iyi B:202-275

Lineage for d1iyib2 (1iyi B:202-275)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)

6. Protein Class sigma GST [81362] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89705] (2 PDB entries)
   synonym: hematopoietic prostaglandin D synthase

8. Domain d1iyib2: 1iyi B:202-275 [83801]
   Other proteins in same PDB: d1iyia1, d1iyib1, d1iyic1, d1iyid1

Details for d1iyib2

PDB Entry: 1iyi, 1.8 Å

PDB Description: Crystal structure of hematopoietic prostaglandin D synthase

SCOP Domain Sequences for d1iyib2:

Sequence; same for both SEQRES and ATOM records:

>d1iyib2 c.47.1.5 (B:202-275) Class sigma GST {Human (Homo sapiens)}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt

Timeline for d1iyib2:

• d1iyib2 is new in SCOP 1.65
  
• d1iyib2 appears in SCOP 1.67
  
• d1iyib2 appears in the current release, SCOPe 2.08