Lineage for d1iyia1 (1iyi A:76-199)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 443394Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 443395Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 443396Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 443722Protein Class sigma GST [81351] (5 species)
  7. 443735Species Human (Homo sapiens) [TaxId:9606] [89061] (2 PDB entries)
    synonym: hematopoietic prostaglandin D synthase
  8. 443740Domain d1iyia1: 1iyi A:76-199 [83798]
    Other proteins in same PDB: d1iyia2, d1iyib2, d1iyic2, d1iyid2

Details for d1iyia1

PDB Entry: 1iyi (more details), 1.8 Å

PDB Description: Crystal structure of hematopoietic prostaglandin D synthase
PDB Compounds: (A:)

SCOP Domain Sequences for d1iyia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyia1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens)}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

SCOP Domain Coordinates for d1iyia1:

Click to download the PDB-style file with coordinates for d1iyia1.
(The format of our PDB-style files is described here.)

Timeline for d1iyia1: