Class a: All alpha proteins [46456] (202 folds) |
Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins) |
Protein Class sigma GST [81351] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [89061] (2 PDB entries) synonym: hematopoietic prostaglandin D synthase |
Domain d1iyhd1: 1iyh D:676-799 [83796] Other proteins in same PDB: d1iyha2, d1iyhb2, d1iyhc2, d1iyhd2 complexed with gsh, mg |
PDB Entry: 1iyh (more details), 1.7 Å
SCOP Domain Sequences for d1iyhd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iyhd1 a.45.1.1 (D:676-799) Class sigma GST {Human (Homo sapiens)} dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl ggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp qtkl
Timeline for d1iyhd1: