Lineage for d1iyhb2 (1iyh B:202-275)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395822Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 395823Superfamily c.47.1: Thioredoxin-like [52833] (14 families) (S)
  5. 395996Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 396311Protein Class sigma GST [81362] (4 species)
  7. 396315Species Human (Homo sapiens) [TaxId:9606] [89705] (2 PDB entries)
    synonym: hematopoietic prostaglandin D synthase
  8. 396317Domain d1iyhb2: 1iyh B:202-275 [83793]
    Other proteins in same PDB: d1iyha1, d1iyhb1, d1iyhc1, d1iyhd1

Details for d1iyhb2

PDB Entry: 1iyh (more details), 1.7 Å

PDB Description: Crystal structure of hematopoietic prostaglandin D synthase
PDB Compounds: (B:)

SCOP Domain Sequences for d1iyhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyhb2 c.47.1.5 (B:202-275) Class sigma GST {Human (Homo sapiens)}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt

SCOP Domain Coordinates for d1iyhb2:

Click to download the PDB-style file with coordinates for d1iyhb2.
(The format of our PDB-style files is described here.)

Timeline for d1iyhb2: