Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
Protein Lysozyme [53961] (14 species) ubiquitous in a variety of tissues and secretions |
Species Human (Homo sapiens) [TaxId:9606] [53969] (200 PDB entries) Uniprot P00695 |
Domain d1ix0a_: 1ix0 A: [83762] complexed with na |
PDB Entry: 1ix0 (more details), 1.8 Å
SCOPe Domain Sequences for d1ix0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ix0a_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]} kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqan srywcndgktpgavnaahlscsallqdniadavaaakrvvrdpqgirawvawrnrcqnrd vrqyvqgcgv
Timeline for d1ix0a_: