SCOP 1.73: Domain d1iwap_: 1iwa P:

Lineage for d1iwap_ (1iwa P:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)

7. Species Galdieria partita [TaxId:83374] [55244] (2 PDB entries)

8. Domain d1iwap_: 1iwa P: [83749]
   Other proteins in same PDB: d1iwaa1, d1iwaa2, d1iwac1, d1iwac2, d1iwae1, d1iwae2, d1iwag1, d1iwag2, d1iwai1, d1iwai2, d1iwak1, d1iwak2, d1iwam1, d1iwam2, d1iwao1, d1iwao2
   complexed with so4

Details for d1iwap_

PDB Entry: 1iwa, 2.6 Å

PDB Description: rubisco from galdieria partita

PDB Compounds: (P:) ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit

SCOP Domain Sequences for d1iwap_:

Sequence; same for both SEQRES and ATOM records:

>d1iwap_ d.73.1.1 (P:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Galdieria partita [TaxId: 83374]}
mritqgtfsflpdltdeqikkqidymiskklaigieytndihprnayweiwglplfdvtd
paavlfeinacrkarsnfyikvvgfssvrgiestiisfivnrpkhepgfnlmrqedksrs
ikytihsyesykpedery

Timeline for d1iwap_:

• d1iwap_ first appeared in SCOP 1.65
  
• d1iwap_ appears in SCOP 1.71
  
• d1iwap_ appears in SCOP 1.75
  
• d1iwap_ appears in the current release, SCOPe 2.08