Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species) |
Species Galdieria partita [TaxId:83374] [54971] (2 PDB entries) |
Domain d1iwam2: 1iwa M:6-149 [83745] Other proteins in same PDB: d1iwaa1, d1iwab_, d1iwac1, d1iwad_, d1iwae1, d1iwaf_, d1iwag1, d1iwah_, d1iwai1, d1iwaj_, d1iwak1, d1iwal_, d1iwam1, d1iwan_, d1iwao1, d1iwap_ complexed with so4 |
PDB Entry: 1iwa (more details), 2.6 Å
SCOPe Domain Sequences for d1iwam2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iwam2 d.58.9.1 (M:6-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Galdieria partita [TaxId: 83374]} triknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpieaaaavagessta twtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeegsianltasiignv fgfkavkalrledmrlplaylktfq
Timeline for d1iwam2: