Lineage for d1iu3f1 (1iu3 F:6-116)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007967Fold d.228: Replication modulator SeqA, C-terminal DNA-binding domain [82807] (1 superfamily)
    consists of seven alpha-helices and three-stranded beta-sheet
  4. 3007968Superfamily d.228.1: Replication modulator SeqA, C-terminal DNA-binding domain [82808] (1 family) (S)
    automatically mapped to Pfam PF03925
  5. 3007969Family d.228.1.1: Replication modulator SeqA, C-terminal DNA-binding domain [82809] (2 proteins)
  6. 3007970Protein Replication modulator SeqA, C-terminal DNA-binding domain [82810] (1 species)
    binds to fully methylated and hemimethylated GATC sequences at oriC
  7. 3007971Species Escherichia coli [TaxId:562] [82811] (3 PDB entries)
    Uniprot P36658 71-181
  8. 3007976Domain d1iu3f1: 1iu3 F:6-116 [83710]
    Other proteins in same PDB: d1iu3c2, d1iu3f2
    protein/DNA complex

Details for d1iu3f1

PDB Entry: 1iu3 (more details), 3 Å

PDB Description: crystal structure of the e.coli seqa protein complexed with hemimethylated dna
PDB Compounds: (F:) SeqA protein

SCOPe Domain Sequences for d1iu3f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iu3f1 d.228.1.1 (F:6-116) Replication modulator SeqA, C-terminal DNA-binding domain {Escherichia coli [TaxId: 562]}
amrelllsdeyaeqkravnrfmlllstlysldaqafaeateslhgrtrvyfaadeqtllk
ngnqtkpkhvpgtpywvitntntgrkcsmiehimqsmqfpaeliekvcgti

SCOPe Domain Coordinates for d1iu3f1:

Click to download the PDB-style file with coordinates for d1iu3f1.
(The format of our PDB-style files is described here.)

Timeline for d1iu3f1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iu3f2