SCOP 1.69: Domain d1itca1: 1itc A:418-516

Lineage for d1itca1 (1itc A:418-516)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.3: Prealbumin-like [49451] (6 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (2 families)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)

6. Protein beta-amylase [49462] (1 species)

7. Species Bacillus cereus [TaxId:1396] [49463] (11 PDB entries)

8. Domain d1itca1: 1itc A:418-516 [83705]
   Other proteins in same PDB: d1itca2

Details for d1itca1

PDB Entry: 1itc, 2.1 Å

PDB Description: beta-amylase from bacillus cereus var. mycoides complexed with maltopentaose

SCOP Domain Sequences for d1itca1:

Sequence; same for both SEQRES and ATOM records:

>d1itca1 b.3.1.1 (A:418-516) beta-amylase {Bacillus cereus}
tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
niefkafikskdgtvkswqtiqqswnpvplkttshtssw

Timeline for d1itca1:

• d1itca1 first appeared in SCOP 1.65
  
• d1itca1 appears in SCOP 1.67
  
• d1itca1 appears in SCOP 1.71
  
• d1itca1 appears in the current release, SCOPe 2.08