Lineage for d1is1a_ (1is1 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 505899Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 505924Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (1 family) (S)
  5. 505925Family d.67.3.1: Ribosome recycling factor, RRF [55195] (1 protein)
  6. 505926Protein Ribosome recycling factor, RRF [55196] (5 species)
  7. 505936Species Vibrio parahaemolyticus [TaxId:670] [89970] (1 PDB entry)
  8. 505937Domain d1is1a_: 1is1 A: [83704]

Details for d1is1a_

PDB Entry: 1is1 (more details), 2.2 Å

PDB Description: Crystal structure of ribosome recycling factor from Vibrio parahaemolyticus

SCOP Domain Sequences for d1is1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1is1a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Vibrio parahaemolyticus}
mineikkdaqermdksvealknnlskvrtgrahpsllsgisveyygaatplnqvanvvae
dartlaitvfdkeltqkvekaimmsdlglnpmsagtiirvplpplteerrkdlvkivrge
aeggrvavrnirrdanndlkallkdkeisededrkaqeeiqkltdvavkkidevlaakek
elmev

SCOP Domain Coordinates for d1is1a_:

Click to download the PDB-style file with coordinates for d1is1a_.
(The format of our PDB-style files is described here.)

Timeline for d1is1a_: