Lineage for d1i7la2 (1i7l A:215-421)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671104Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1671105Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1671308Family d.142.1.3: Synapsin C-terminal domain [56078] (3 proteins)
    automatically mapped to Pfam PF02750
  6. 1671326Protein Synapsin II [90030] (1 species)
  7. 1671327Species Norway rat (Rattus norvegicus) [TaxId:10116] [90031] (2 PDB entries)
  8. 1671330Domain d1i7la2: 1i7l A:215-421 [83678]
    Other proteins in same PDB: d1i7la1, d1i7lb1
    complexed with atp

Details for d1i7la2

PDB Entry: 1i7l (more details), 2.35 Å

PDB Description: crystal structure analysis of the complex of the c domain of synapsin ii from rat with atp
PDB Compounds: (A:) synapsin II

SCOPe Domain Sequences for d1i7la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i7la2 d.142.1.3 (A:215-421) Synapsin II {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nslesiynfcdkpwvfaqmvaifktlggekfplieqtyypnhremltlptfpvvvkigha
hsgmgkvkvenhydfqdiasvvaltqtyataepfidakydirvqkignnykaymrtsisg
nwktntgsamleqiamsdryklwvdacsemfggldicavkavhgkdgkdyifevmdcsmp
ligehqvedrqlitdlviskmnqllsr

SCOPe Domain Coordinates for d1i7la2:

Click to download the PDB-style file with coordinates for d1i7la2.
(The format of our PDB-style files is described here.)

Timeline for d1i7la2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i7la1