Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) |
Family d.142.1.3: Synapsin C-terminal domain [56078] (3 proteins) automatically mapped to Pfam PF02750 |
Protein Synapsin II [90030] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [90031] (2 PDB entries) |
Domain d1i7la2: 1i7l A:215-421 [83678] Other proteins in same PDB: d1i7la1, d1i7lb1 complexed with atp |
PDB Entry: 1i7l (more details), 2.35 Å
SCOPe Domain Sequences for d1i7la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i7la2 d.142.1.3 (A:215-421) Synapsin II {Norway rat (Rattus norvegicus) [TaxId: 10116]} nslesiynfcdkpwvfaqmvaifktlggekfplieqtyypnhremltlptfpvvvkigha hsgmgkvkvenhydfqdiasvvaltqtyataepfidakydirvqkignnykaymrtsisg nwktntgsamleqiamsdryklwvdacsemfggldicavkavhgkdgkdyifevmdcsmp ligehqvedrqlitdlviskmnqllsr
Timeline for d1i7la2: