Lineage for d1hy2d_ (1hy2 D:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 958655Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 958656Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 958657Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 958680Protein Streptavidin [50878] (1 species)
  7. 958681Species Streptomyces avidinii [TaxId:1895] [50879] (118 PDB entries)
  8. 958915Domain d1hy2d_: 1hy2 D: [83654]
    complexed with miniprotein MP-1, chains E, F, G and H

Details for d1hy2d_

PDB Entry: 1hy2 (more details), 2 Å

PDB Description: miniprotein mp-1 complex with streptavidin
PDB Compounds: (D:) streptavidin

SCOPe Domain Sequences for d1hy2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hy2d_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

SCOPe Domain Coordinates for d1hy2d_:

Click to download the PDB-style file with coordinates for d1hy2d_.
(The format of our PDB-style files is described here.)

Timeline for d1hy2d_: