![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
![]() | Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) ![]() |
![]() | Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) |
![]() | Protein Streptavidin [50878] (1 species) |
![]() | Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries) |
![]() | Domain d1hy2c_: 1hy2 C: [83653] complexed with miniprotein MP-1, chains E, F, G and H |
PDB Entry: 1hy2 (more details), 2 Å
SCOPe Domain Sequences for d1hy2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hy2c_ b.61.1.1 (C:) Streptavidin {Streptomyces avidinii [TaxId: 1895]} aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk vkp
Timeline for d1hy2c_: