Lineage for d1hy2b_ (1hy2 B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 806367Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 806368Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 806369Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 806398Protein Streptavidin [50878] (1 species)
  7. 806399Species Streptomyces avidinii [TaxId:1895] [50879] (118 PDB entries)
  8. 806597Domain d1hy2b_: 1hy2 B: [83652]
    complexed with miniprotein MP-1, chains E, F, G and H

Details for d1hy2b_

PDB Entry: 1hy2 (more details), 2 Å

PDB Description: miniprotein mp-1 complex with streptavidin
PDB Compounds: (B:) streptavidin

SCOP Domain Sequences for d1hy2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hy2b_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

SCOP Domain Coordinates for d1hy2b_:

Click to download the PDB-style file with coordinates for d1hy2b_.
(The format of our PDB-style files is described here.)

Timeline for d1hy2b_: