Lineage for d1hy2a_ (1hy2 A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 301239Fold b.61: Streptavidin-like [50875] (5 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 301240Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 301241Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 301264Protein Streptavidin [50878] (1 species)
  7. 301265Species Streptomyces avidinii [TaxId:1895] [50879] (98 PDB entries)
  8. 301425Domain d1hy2a_: 1hy2 A: [83651]

Details for d1hy2a_

PDB Entry: 1hy2 (more details), 2 Å

PDB Description: miniprotein mp-1 complex with streptavidin

SCOP Domain Sequences for d1hy2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hy2a_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

SCOP Domain Coordinates for d1hy2a_:

Click to download the PDB-style file with coordinates for d1hy2a_.
(The format of our PDB-style files is described here.)

Timeline for d1hy2a_: