SCOP 1.75: Domain d1hq4d1: 1hq4 D:1-113

Lineage for d1hq4d1 (1hq4 D:1-113)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (38 PDB entries)
   Uniprot P18532 # HV61_MOUSE Ig heavy chain V region 1B43 precursor

8. Domain d1hq4d1: 1hq4 D:1-113 [83627]
   Other proteins in same PDB: d1hq4a1, d1hq4a2, d1hq4b2, d1hq4c1, d1hq4c2, d1hq4d2
   part of catalytic Fab HA-19A4 with a polyene cyclase activity
   complexed with cd

Details for d1hq4d1

PDB Entry: 1hq4, 2.7 Å

PDB Description: structure of native catalytic antibody ha5-19a4

PDB Compounds: (D:) antibody ha5-19a4 fab heavy chain

SCOP Domain Sequences for d1hq4d1:

Sequence; same for both SEQRES and ATOM records:

>d1hq4d1 b.1.1.1 (D:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]}
dvqlqesgpglvkpsqslsltctvtgysitsgyawnwirqfpgnklewmgyirysgdtry
npslksrisitrdtsknqfflqlnsvttedtatyycaigygnsdywgqgtlvtvsa

Timeline for d1hq4d1:

• d1hq4d1 first appeared in SCOP 1.65
  
• d1hq4d1 appears in SCOP 1.73
  
• d1hq4d1 appears in SCOPe 2.01
  
• d1hq4d1 appears in the current release, SCOPe 2.08