SCOP 1.69: Domain d1hq4b2: 1hq4 B:114-213

Lineage for d1hq4b2 (1hq4 B:114-213)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)

8. Domain d1hq4b2: 1hq4 B:114-213 [83624]
   Other proteins in same PDB: d1hq4a1, d1hq4a2, d1hq4b1, d1hq4c1, d1hq4c2, d1hq4d1

Details for d1hq4b2

PDB Entry: 1hq4, 2.7 Å

PDB Description: structure of native catalytic antibody ha5-19a4

SCOP Domain Sequences for d1hq4b2:

Sequence; same for both SEQRES and ATOM records:

>d1hq4b2 b.1.1.2 (B:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhafpallqsg
lytmsssvtvpsstwpsqtvtcsvahpassttvdkklepk

Timeline for d1hq4b2:

• d1hq4b2 first appeared in SCOP 1.65
  
• d1hq4b2 appears in SCOP 1.67
  
• d1hq4b2 appears in SCOP 1.71
  
• d1hq4b2 appears in the current release, SCOPe 2.08