Lineage for d1hn0a3 (1hn0 A:900-1021)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 370953Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 370954Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (1 family) (S)
  5. 370955Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins)
  6. 370956Protein Chondroitin ABC lyase I [89266] (1 species)
    domain 4
  7. 370957Species Proteus vulgaris [TaxId:585] [89267] (1 PDB entry)
  8. 370958Domain d1hn0a3: 1hn0 A:900-1021 [83618]
    Other proteins in same PDB: d1hn0a1, d1hn0a2, d1hn0a4
    complexed with na

Details for d1hn0a3

PDB Entry: 1hn0 (more details), 1.9 Å

PDB Description: crystal structure of chondroitin abc lyase i from proteus vulgaris at 1.9 angstroms resolution

SCOP Domain Sequences for d1hn0a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hn0a3 b.24.1.1 (A:900-1021) Chondroitin ABC lyase I {Proteus vulgaris}
yqvlrkdkdvhiildklsnvtgyafyqpasiedkwikkvnkpaivmthrqkdtlivsavt
pdlnmtrqkaatpvtinvtingkwqsadknsevkyqvsgdnteltftsyfgipqeiklsp
lp

SCOP Domain Coordinates for d1hn0a3:

Click to download the PDB-style file with coordinates for d1hn0a3.
(The format of our PDB-style files is described here.)

Timeline for d1hn0a3: