Lineage for d1hl6c_ (1hl6 C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195051Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 2195315Protein RNA-binding protein 8 [89938] (2 species)
  7. 2195316Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [89939] (3 PDB entries)
    CG8781 protein
  8. 2195320Domain d1hl6c_: 1hl6 C: [83611]
    Other proteins in same PDB: d1hl6b_, d1hl6d_

Details for d1hl6c_

PDB Entry: 1hl6 (more details), 2.5 Å

PDB Description: a novel mode of rbd-protein recognition in the y14-mago complex
PDB Compounds: (C:) cg8781 protein

SCOPe Domain Sequences for d1hl6c_:

Sequence, based on SEQRES records: (download)

>d1hl6c_ d.58.7.1 (C:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
efevdedgdqgivrlkekakhrkgrgfgsdsntreaihsyervrnedddelepgpqrsve
gwilfvtsiheeaqedeiqekfcdygeiknihlnldrrtgfskgyalveyethkqalaak
ealngaeimgqtiqvdwcfvk

Sequence, based on observed residues (ATOM records): (download)

>d1hl6c_ d.58.7.1 (C:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
efevdedgdqgivrlkekakhrkgrgfpgpqrsvegwilfvtsiheeaqedeiqekfcdy
geiknihlnlfskgyalveyethkqalaakealngaeimgqtiqvdwcfvk

SCOPe Domain Coordinates for d1hl6c_:

Click to download the PDB-style file with coordinates for d1hl6c_.
(The format of our PDB-style files is described here.)

Timeline for d1hl6c_: