Lineage for d1hl3a2 (1hl3 A:15-114,A:308-346)
- Root: SCOP 1.67
Class c: Alpha and beta proteins (a/b) [51349] (130 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) 
Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins)
this domain is interrupted by the Rossmann-fold domain
Protein Transcription corepressor CtbP [82347] (2 species)
C-terminal binding protein 1; a dehydrogenase
Species Rat (Rattus norvegicus), Ctbp3 [TaxId:10116] [89597] (2 PDB entries) 
Domain d1hl3a2: 1hl3 A:15-114,A:308-346 [83586]
Other proteins in same PDB: d1hl3a1
complexed with nad
Details for d1hl3a2
PDB Entry: 1hl3 (more details), 3.1 Å
PDB Description: ctbp/bars in ternary complex with nad(h) and pidlskk peptide
SCOP Domain Sequences for d1hl3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hl3a2 c.23.12.1 (A:15-114,A:308-346) Transcription corepressor CtbP {Rat (Rattus norvegicus), Ctbp3}
prplvalldgrdctvempilkdvatvafcdaqstqeihekvlneavgalmyhtitltred
lekfkalriivrigsgfdnidiksagdlgiavcnvpaasvXyseqasiemreeaareirr
aitgripdslkncvnkdhlt
SCOP Domain Coordinates for d1hl3a2:
Click to download the PDB-style file with coordinates for d1hl3a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hl3a2:
- d1hl3a2 first appeared in SCOP 1.65
- d1hl3a2 appears in SCOP 1.69
- d1hl3a2 appears in the current release, SCOPe 2.08
View in 3D
