Lineage for d1hl3a2 (1hl3 A:15-114,A:308-346)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857659Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 2857660Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins)
    this domain is interrupted by the Rossmann-fold domain
  6. 2857714Protein Transcription corepressor CtbP [82347] (2 species)
    C-terminal binding protein 1; a dehydrogenase
  7. 2857720Species Norway rat (Rattus norvegicus), Ctbp3 [TaxId:10116] [89597] (2 PDB entries)
  8. 2857722Domain d1hl3a2: 1hl3 A:15-114,A:308-346 [83586]
    Other proteins in same PDB: d1hl3a1
    complexed with nad

Details for d1hl3a2

PDB Entry: 1hl3 (more details), 3.1 Å

PDB Description: ctbp/bars in ternary complex with nad(h) and pidlskk peptide
PDB Compounds: (A:) c-terminal binding protein 3

SCOPe Domain Sequences for d1hl3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hl3a2 c.23.12.1 (A:15-114,A:308-346) Transcription corepressor CtbP {Norway rat (Rattus norvegicus), Ctbp3 [TaxId: 10116]}
prplvalldgrdctvempilkdvatvafcdaqstqeihekvlneavgalmyhtitltred
lekfkalriivrigsgfdnidiksagdlgiavcnvpaasvXyseqasiemreeaareirr
aitgripdslkncvnkdhlt

SCOPe Domain Coordinates for d1hl3a2:

Click to download the PDB-style file with coordinates for d1hl3a2.
(The format of our PDB-style files is described here.)

Timeline for d1hl3a2: