SCOP 1.67: Domain d1hl3a1: 1hl3 A:115-307

Lineage for d1hl3a1 (1hl3 A:115-307)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families)

5. Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
   this domain interrupts the other domain which defines family

6. Protein Transcription corepressor CtbP [82298] (2 species)
   C-terminal binding protein 1; a dehydrogenase

7. Species Rat (Rattus norvegicus), Ctbp3 [TaxId:10116] [89529] (2 PDB entries)

8. Domain d1hl3a1: 1hl3 A:115-307 [83585]
   Other proteins in same PDB: d1hl3a2
   complexed with nad

Details for d1hl3a1

PDB Entry: 1hl3, 3.1 Å

PDB Description: ctbp/bars in ternary complex with nad(h) and pidlskk peptide

SCOP Domain Sequences for d1hl3a1:

Sequence; same for both SEQRES and ATOM records:

>d1hl3a1 c.2.1.4 (A:115-307) Transcription corepressor CtbP {Rat (Rattus norvegicus), Ctbp3}
eetadstlchilnlyrrttwlhqalregtrvqsveqirevasgaarirgetlgiiglgrv
gqavalrakafgfnvlfydpylsdgieralglqrvstlqdllfhsdcvtlhcglnehnhh
lindftvkqmrqgaflvntargglvdekalaqalkegrirgaaldvhesepfsfsqgplk
dapnlictphaaw

Timeline for d1hl3a1:

• d1hl3a1 first appeared in SCOP 1.65
  
• d1hl3a1 appears in SCOP 1.69
  
• d1hl3a1 appears in the current release, SCOPe 2.08