Lineage for d1hl3a1 (1hl3 A:115-307)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 308772Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 308863Protein Transcription corepressor CtbP [82298] (2 species)
    C-terminal binding protein 1; a dehydrogenase
  7. 308866Species Rat (Rattus norvegicus), Ctbp3 [TaxId:10116] [89529] (2 PDB entries)
  8. 308868Domain d1hl3a1: 1hl3 A:115-307 [83585]
    Other proteins in same PDB: d1hl3a2
    complexed with nad

Details for d1hl3a1

PDB Entry: 1hl3 (more details), 3.1 Å

PDB Description: ctbp/bars in ternary complex with nad(h) and pidlskk peptide

SCOP Domain Sequences for d1hl3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hl3a1 c.2.1.4 (A:115-307) Transcription corepressor CtbP {Rat (Rattus norvegicus), Ctbp3}
eetadstlchilnlyrrttwlhqalregtrvqsveqirevasgaarirgetlgiiglgrv
gqavalrakafgfnvlfydpylsdgieralglqrvstlqdllfhsdcvtlhcglnehnhh
lindftvkqmrqgaflvntargglvdekalaqalkegrirgaaldvhesepfsfsqgplk
dapnlictphaaw

SCOP Domain Coordinates for d1hl3a1:

Click to download the PDB-style file with coordinates for d1hl3a1.
(The format of our PDB-style files is described here.)

Timeline for d1hl3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hl3a2