| Class b: All beta proteins [48724] (180 folds) |
| Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) ![]() the barrel is decorated with additional structures |
| Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins) barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel |
| Protein Diaminopimelate decarboxylase LysA [89350] (3 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [89351] (2 PDB entries) |
| Domain d1hkwb1: 1hkw B:3-45,B:311-446 [83565] Other proteins in same PDB: d1hkwa2, d1hkwb2 complexed with so4 |
PDB Entry: 1hkw (more details), 2.8 Å
SCOPe Domain Sequences for d1hkwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hkwb1 b.49.2.3 (B:3-45,B:311-446) Diaminopimelate decarboxylase LysA {Mycobacterium tuberculosis [TaxId: 1773]}
ellhlapnvwprnttrdevgvvciagipltqlaqeygtplfviXitlyevgtvkdvdvsa
tahrryvsvdggmsdnirtalygaqydvrlvsrvsdappvparlvgkhcesgdiivrdtw
vpddirpgdlvavaatgaycyslssrynmvgrpavvavhagnarlvlrretvddllslev
Timeline for d1hkwb1: