Lineage for d1hkwa2 (1hkw A:46-310)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 473860Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
    circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand
  5. 473861Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins)
  6. 473888Protein Diaminopimelate decarboxylase LysA [89457] (3 species)
    most similar to eukaryotic ODC
  7. 473899Species Mycobacterium tuberculosis [TaxId:1773] [89458] (2 PDB entries)
  8. 473902Domain d1hkwa2: 1hkw A:46-310 [83564]
    Other proteins in same PDB: d1hkwa1, d1hkwb1

Details for d1hkwa2

PDB Entry: 1hkw (more details), 2.8 Å

PDB Description: mycobacterium diaminopimelate dicarboxylase (lysa)

SCOP Domain Sequences for d1hkwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hkwa2 c.1.6.1 (A:46-310) Diaminopimelate decarboxylase LysA {Mycobacterium tuberculosis}
deddfrsrcretaaafgsganvhyaakaflcsevarwiseeglcldvctggelavalhas
fpperitlhgnnksvseltaavkagvghivvdsmteierldaiageagivqdvlvrltvg
veahthefistahedqkfglsvasgaamaavrrvfatdhlrlvglhshigsqifdvdgfe
laahrvigllrdvvgefgpektaqiatvdlggglgisylpsddpppiaelaaklgtivsd
estavglptpklvvepgraiagpgt

SCOP Domain Coordinates for d1hkwa2:

Click to download the PDB-style file with coordinates for d1hkwa2.
(The format of our PDB-style files is described here.)

Timeline for d1hkwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hkwa1