SCOPe 2.07: Domain d1hkwa1: 1hkw A:2-45,A:311-447

Lineage for d1hkwa1 (1hkw A:2-45,A:311-447)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
   barrel, closed; n=6, S=8; greek-key
   Many cradle-loop superfamilies may be homologous, according to PubMed 18457946

4. Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families)
   the barrel is decorated with additional structures

5. Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
   barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel

6. Protein Diaminopimelate decarboxylase LysA [89350] (3 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [89351] (2 PDB entries)

8. Domain d1hkwa1: 1hkw A:2-45,A:311-447 [83563]
   Other proteins in same PDB: d1hkwa2, d1hkwb2
   complexed with so4

Details for d1hkwa1

PDB Entry: 1hkw, 2.8 Å

PDB Description: mycobacterium diaminopimelate dicarboxylase (lysa)

PDB Compounds: (A:) diaminopimelate decarboxylase

SCOPe Domain Sequences for d1hkwa1:

Sequence; same for both SEQRES and ATOM records:

>d1hkwa1 b.49.2.3 (A:2-45,A:311-447) Diaminopimelate decarboxylase LysA {Mycobacterium tuberculosis [TaxId: 1773]}
nellhlapnvwprnttrdevgvvciagipltqlaqeygtplfviXitlyevgtvkdvdvs
atahrryvsvdggmsdnirtalygaqydvrlvsrvsdappvparlvgkhcesgdiivrdt
wvpddirpgdlvavaatgaycyslssrynmvgrpavvavhagnarlvlrretvddllsle
vr

Timeline for d1hkwa1:

• d1hkwa1 first appeared in SCOP 1.65
  
• d1hkwa1 appears in SCOPe 2.06
  
• d1hkwa1 appears in the current release, SCOPe 2.08